HORDB

ID: hor006396
Uniprot ID: P10082
Protein name: Peptide YY
Gene name: PYY
Organism: Homo sapiens (Human)
Family: NPY family
Source: Human
Expression: NA
Disease: Diseases associated with PYY include Anorexia Nervosa and N-Acetylglutamate Synthase Deficiency.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0060575 intestinal epithelial cell differentiation
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Length: 36(29-64)
Propeptide: MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW
Signal peptide: MVFVRRPWPALTTVLLALLVCLGALVDA
Modification: T13 Phosphoserine;T36 Tyrosine amide
Glycosylation: NA
Mutagenesis: NA

Function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Mechanism: NA
Cross BBB: NA
Target: NPY2R, NPY1R
Target Unid: P49146, P25929
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

2dez.pdb

hor006396_AF2.pdb

hor006396_ESM.pdb

Mass:	503437	Formula:	C198H303N57O58
Absent amino acids:	CFGMW	Common amino acids:	RY
pI:	8.92	Basic residues:	7
Polar residues:	10	Hydrophobic residues:	9
Hydrophobicity:	-120.83	Boman Index:	-11559
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	70.56
Instability Index:	7993.33	Extinction Coefficient cystines:	7450
Absorbance 280nm:	212.86

PubMed ID: 8318545
Title: Cloning and structural determination of human peptide YY cDNA and gene.
PubMed ID: 16625196
Title: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Co
PubMed ID: 3202875
Title:
PubMed ID: 2587421
Title:
PubMed ID: 21314817
Title:
PubMed ID: 16819834
Title: