General Information

  • ID:  hor006396
  • Uniprot ID:  P10082
  • Protein name:  Peptide YY
  • Gene name:  PYY
  • Organism:  Homo sapiens (Human)
  • Family:  NPY family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with PYY include Anorexia Nervosa and N-Acetylglutamate Synthase Deficiency.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0060575 intestinal epithelial cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
  • Length:  36(29-64)
  • Propeptide:  MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW
  • Signal peptide:  MVFVRRPWPALTTVLLALLVCLGALVDA
  • Modification:  T13 Phosphoserine;T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPY2R, NPY1R
  • Target Unid:  P49146, P25929
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10082-F1(AlphaFold_DB_ID)/2DEZ(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    2dez.pdbhor006396_AF2.pdbhor006396_ESM.pdb

Physical Information

Mass: 503437 Formula: C198H303N57O58
Absent amino acids: CFGMW Common amino acids: RY
pI: 8.92 Basic residues: 7
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -120.83 Boman Index: -11559
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 70.56
Instability Index: 7993.33 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  8318545
  • Title:  Cloning and structural determination of human peptide YY cDNA and gene.
  • PubMed ID:  16625196
  • Title:  DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Co
  • PubMed ID:  3202875
  • Title:  
  • PubMed ID:  2587421
  • Title:  
  • PubMed ID:  21314817
  • Title:  
  • PubMed ID:  16819834
  • Title: